PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcS521408.10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 214aa    MW: 24598.6 Da    PI: 10.5035
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcS521408.10genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.74e-301059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rienk+ rqvtfskRrng+lKKA+ELSvLCdaeva iifs+tgklye+s+
  EcS521408.10 10 RIENKTSRQVTFSKRRNGLLKKAFELSVLCDAEVAAIIFSPTGKLYEFST 59
                  8***********************************************96 PP

2K-box44.75.6e-16831711098
         K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                    e + ++ + ++  + k ie L  ++ +l Ge  +++s++eLq+ ++ Le+sl+kiR++Kn l++eqi  l++ ek+l +enk+Lr+k 
  EcS521408.10  83 MEIDLQNIKGNSLDMAKMIELLNVSNSRLSGELSNTCSIEELQSTQNLLERSLSKIRARKNLLFKEQIMLLKQEEKKLLDENKKLRSKN 171
                   56678899999999*********999************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.6E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.469161IPR002100Transcription factor, MADS-box
CDDcd002651.50E-41370No hitNo description
PRINTSPR004041.1E-29323IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-33375IPR002100Transcription factor, MADS-box
PfamPF003191.5E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-1486170IPR002487Transcription factor, K-box
PROSITE profilePS5129711.29287177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MVRGKTQMRR IENKTSRQVT FSKRRNGLLK KAFELSVLCD AEVAAIIFSP TGKLYEFSTS  60
SMSSIIERYQ RKTKDPGCSK KTMEIDLQNI KGNSLDMAKM IELLNVSNSR LSGELSNTCS  120
IEELQSTQNL LERSLSKIRA RKNLLFKEQI MLLKQEEKKL LDENKKLRSK NEVRGPLKFV  180
TEHPEVPRGQ GLDVETELSI GCPQRYRLNN MRKV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D3e-18369268Myocyte-specific enhancer factor 2A
3mu6_C3e-18369268Myocyte-specific enhancer factor 2A
3mu6_B3e-18369268Myocyte-specific enhancer factor 2A
3mu6_A3e-18369268Myocyte-specific enhancer factor 2A
1egw_D4e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-18369268MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J4e-18369268Myocyte-specific enhancer factor 2A
3p57_I4e-18369268Myocyte-specific enhancer factor 2A
3p57_D4e-18369268Myocyte-specific enhancer factor 2A
3p57_C4e-18369268Myocyte-specific enhancer factor 2A
3p57_B4e-18369268Myocyte-specific enhancer factor 2A
3p57_A4e-18369268Myocyte-specific enhancer factor 2A
3kov_J4e-18369268Myocyte-specific enhancer factor 2A
3kov_I4e-18369268Myocyte-specific enhancer factor 2A
3kov_B4e-18369268Myocyte-specific enhancer factor 2A
3kov_A4e-18369268Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055578.11e-147PREDICTED: MADS-box protein SOC1-like isoform X1
SwissprotO646455e-64SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A059C1J81e-147A0A059C1J8_EUCGR; Uncharacterized protein
STRINGVIT_02s0025g04650.t013e-69(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-59AGAMOUS-like 20